PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun000257
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34785.5 Da    PI: 4.6232
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-5237PU_refplantGDBView CDS
PUT-167a-Vigna_unguiculata-5035354PU_unrefplantGDBView CDS
gnl|UG|Vun#S45909856PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.3e-1962115356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Vun000257  62 KKRRLSIDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 115
                5568999**********************************************9 PP

2HD-ZIP_I/II130.37.8e-4261153193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk+++dalk + ++L++++e+Lr+++ke
    Vun000257  61 EKKRRLSIDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANFDALKLNYDTLNHDNEALRKQIKE 153
                  69****************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1946119IPR009057Homeodomain-like
PROSITE profilePS5007117.73457117IPR001356Homeobox domain
SMARTSM003891.4E-1760121IPR001356Homeobox domain
PfamPF000465.6E-1662115IPR001356Homeobox domain
CDDcd000863.32E-1662118No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2064124IPR009057Homeodomain-like
PRINTSPR000318.3E-68897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000318.3E-697113IPR000047Helix-turn-helix motif
PfamPF021833.2E-17117158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MKRLSSSDSP STPLITICPS TTEEHGTRNC QQHVYGREFQ SMMLEGLDEE GCVDEVGHQS  60
EKKRRLSIDQ VKALEKNFEV ENKLEPERKV KLAQELGLQP RQVAVWFQNR RARWKTKQLE  120
RDYGVLKANF DALKLNYDTL NHDNEALRKQ IKELKSRLEE ENTGSGGVSV KEEIMMPDSE  180
DKTTMEQSKS EPSSESEDQL KYECFNANNN NNGCFVGASL FPVDFKDGSS DSDSSAILNE  240
ENHCSPITEH LLLSPESSSM NCLQFQKAYQ AQYVVKMEEH NFFSADEACN FFSDEQAPTL  300
QWWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494340.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A0L9UAB40.0A0A0L9UAB4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S1070.0A0A0S3S107_PHAAN; Uncharacterized protein
STRINGGLYMA18G01830.11e-135(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.19e-69homeobox protein 6